Repbase Reports |
---|
2004, Volume 4, Issue 8 |
August 31, 2004 |
Copyright © 2001-2016 - Genetic Information Research Institute |
ISSN# 1534-830X |
Page 215 |
MUDR5A_CB |
|||
---|---|---|---|
Caenorhabditis briggsae family of DNA transposons - a consensus. |
|||
Submitted: 00-Aug-2004 |
Accepted: 31-Aug-2004 |
||
Key Words: DNA; MUDR superfamily; Cb000282; MUDR5A_CB |
|||
Source: consensus |
Organism: Caenorhabditis briggsae |
Taxonomy: Eukaryota; Fungi/Metazoa group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis |
|
[2] |
Authors: Pavlicek,A. and Jurka,J. |
||
Title: MUDR5A_CB - a family of nonautonomous MUDR-like transposons. |
|||
Journal: Repbase Reports 4:(8) p.215 (2004) |
|||
Abstract: The consensus sequence was reconstructed from the Ensemble genome annotation. Copies are 99% identical to the consensus. Contains 220bp-long TIRs and is flanked by 9bp target duplications. The central part contains an ORF with no clear similarity to known transposases. One variant listed as MUDR5B_CB. MUDR5A_CB_ORF: 3719-4430 (237 aa) MPRSSEYSRKVLDFTVEEFANQINQRRKRRKKIPDRKYSKRSHNNGGRTVSEFKKVNRNVSGESESGDDE RKADGNISSDEENDSDCDVNSLNSKPNVFDESGDIVEDEINCNSNDEHVNLVLDPSVDHLNSHDSCMDLS DDPRKYDSDSDEENDIFGYQNVNPVPKPSNRVSNDHSSQIDLRDVLGEKGSRKPESDSEEVTDVSTGQHV KPMSLKEKFPIGYMHRLSDDSDDSETK
|
|||
Derived: [2] (Consensus) |
|||
Download Sequence - Format: IG, EMBL, FASTA |
|||
References:
|