Repbase Reports |
---|
2004, Volume 4, Issue 11 |
November 30, 2004 |
Copyright © 2001-2016 - Genetic Information Research Institute |
ISSN# 1534-830X |
Page 294 |
MARINER45_CB |
|||
---|---|---|---|
Caenorhabditis briggsae family of DNA transposons - a consensus. |
|||
Submitted: 00-Nov-2004 |
Accepted: 30-Nov-2004 |
||
Key Words: DNA; mariner/Tc1 superfamily; transposase; 3bp TSD; Cb000088; MARINER45_CB |
|||
Source: consensus |
Organism: Caenorhabditis briggsae |
Taxonomy: Eukaryota; Fungi/Metazoa group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis |
|
[2] |
Authors: Pavlicek,A. and Jurka,J. |
||
Title: MARINER45_CB - a family of autonomous mariner/Tc1-like transposons. |
|||
Journal: Repbase Reports 4:(11) p.294 (2004) |
|||
Abstract: The consensus sequence was reconstructed from the Ensembl genome annotation. Copies are 99% identical to the consensus. MARINER45_CB contains 285bp-long TIRs and is flanked by TNA target duplications. C|TNA|G target motif. The family contains two autonomous genomic elements with an intact ORF encoding for a 298 aa transposase, and several nonautonomous copies with deletions in the ORF. MARINER45_CB is related to TC5, TC4 from C. elegans and FOT1_FO from Fusarium oxysporum. MARINER45_CB_ORF: 1060-1954 (298 aa) MELEKEVRMHIENGKILHDSVLRFLIAGIIKKYKIDIENFIGSESWLNGWKARFGITSRKITKFVSTIRH KTRDQIEKDSKEFVTAANQVFPLYHPSNIYNADQSGFQIEMHTARTLTLKGSRNVHCVVGSESSTTHSYT VLPLISASGKLHPKLFVTLKEPKGQFPQKGHFQASNLEVTCHTSHIMTKELMKVFFQKIVFDSSMPKDAL LIVDSWNSWKDTAAIDSVTPSSHKLKLLTIPAGCTGRIQPCDVGIFGSFKKVVKTLTNYAQLTNSNYKFQ TRDETLKVSYLFVKQFKK
|
|||
Derived: [2] (Consensus) |
|||
Download Sequence - Format: IG, EMBL, FASTA |
|||
References:
|