Repbase Reports |
|---|
| 2003, Volume 3, Issue 5 |
| May 31, 2003 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 95 |
Merlin1m_CE |
|||
|---|---|---|---|
Nonautonomous DNA transposon Merlin1m_CE. |
|||
|
Submitted: 31-May-2003 |
Accepted: 31-May-2003 |
||
|
Key Words: Nonautonomous DNA transposon, Merlin/IS1016 superfamily; 8-bp TSD; Merlin1m_CE |
|||
|
Source: Caenorhabditis elegans |
Organism: Caenorhabditis elegans |
Taxonomy: Eukaryotae; mitochondrial eukaryotes; Metazoa/Eumycota group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Secernentea; Rhabditia; Rhabditida; Rhabditina; Rhabditoidea; Rhabditidae; Caenorhabditis |
|
| [1] |
Authors: Feschotte,C. and Wessler,S.R. |
||
|
Title: Merlin1m_CE, a nonautonomous family of Merlin/IS1016-like DNA transposons from the the nematode C. elegans |
|||
|
Journal: Repbase Reports 3:(5) p. 95 (2003) |
|||
Abstract: Merlin1m_CE contains a short stretch of coding sequences (41 aa, VEIDESLFSKRKNNSGRILPQLWIFGGICRETGEFFLTEVD) with 46% identity (60% similarity) to the Merlin1_CB transposase (from nematode C. briggsae). Merlin1m_CE TIRs are very similar to those of elements from the PAL8C families. Presumably, PAL8C_1-PAL8C_5 belong also to the Merlin group of DNA transposons.
|
|||
|
Derived: Positions 40499 40112 Accession No AF003130 GenBank |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||