Repbase Reports |
|---|
| 2003, Volume 3, Issue 11 |
| November 30, 2003 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 195 |
Mariner-2_AN |
|||
|---|---|---|---|
DNA transposon, Mariner superfamily, Tc1 clade - a consensus sequence. |
|||
|
Submitted: 30-Nov-2003 |
Accepted: 30-Nov-2003 |
||
|
Key Words: DNA transposon; transposase; Mariner superfamily; Tc1 clade; Mariner-2_AN |
|||
|
Source: consensus |
Organism: Emericella nidulans (Aspergillus nidulans) |
Taxonomy: cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: Mariner-2_AN, a family of nonautonomous DNA transposons in the Aspergillus nidulans genome. |
|||
|
Journal: Repbase Reports 3:(11) p. 195 (2003) |
|||
Abstract: DNA transposon. Mariner superfamily. Tc1 clade. The consensus sequence was reconstructed based on multiple alignment of 3 copies. They are 99% identical to the consensus. Mariner-2_AN elements are characterized by TA target site duplications and 37-bp TIRs. It encodes a 393-aa Mariner-2_ANp transposase (2 exons, pos. 291-1116, 1318-1673). The transposase is closest to mariner/tc1 transposases from frog and fly (GenBank, AAP49009.1 and CAA82359, respectively). Mariner-2_ANp: MPRGGFHPVELRVQVLTLSAIGFSTEKISKSLNLSPRTVQSIVKKGRDRGYRPEVSLRVQ LEFVEDRKRSGRPVEITEATQNTVITSVTADRAGREKLSEILAYEAGISHSSVLCILHSH GFVIAKPSWKPGLTEAACLRRLEFCLAHQHWTLEDWKRVIFTDETGVILGHRRGAIRVWR TVKDSHTRNCVRRRWKACSDFMVWGCFSYNKKGPLHIYKPETAAMRKQADIEIEAMNREL EPLCREEWELATGLSRVHLRPNRGRVPKWNWNEKNEDSAPAHCHRIQQHVYKAEDVQKIL DWPGNSPDLNAIEPCWAWMKKRTTSRGAPRDKKTGEAEWRQAWADLPQETIQHWIERLIR HIQIVIELEGGNEYKEGREDRDTRSWAGRRIKG
|
|||
|
Derived: [1] (Consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||