Repbase Reports |
---|
2002, Volume 2, Issue 6 |
June 30, 2002 |
Copyright © 2001-2016 - Genetic Information Research Institute |
ISSN# 1534-830X |
Page 23 |
Tc1-4_DR |
|||
---|---|---|---|
Tc1-4_DR is an autonomous DNA transposon - a consensus. |
|||
Submitted: 30-Jun-2002 |
Accepted: 30-Jun-2002 |
||
Key Words: Autonomous DNA transposon; Tc1 superfamily; TA target site; TIR; Dr000076; Dr000078; Tc1-4_DR |
|||
Source: consensus |
Organism: Danio rerio |
Taxonomy: Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio |
|
[3] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
Title: Tc1-4_DR, an ancient Tc1-like autonomous DNA transposon from zebrafish. |
|||
Journal: Repbase Reports 2:(6) p. 23 (2002) |
|||
Abstract: Tc1-4_DR copies are flanked by the TA target site duplications generated upon their integration in the genome. Tc1-4 has perfect 51-bp terminal inverted repeats that belong to ~200-bp imperfect TIRs. There are approximately 1500 copies of Tc1-4_DR harbored by the zebrafish genome, they are ~13% divergent from the consensus sequence. The reconstructed 340-aa transposase, Tc1-4_DRp, is encoded by this transposon (positions 350-1369). Tc1-4_DRp: MGRGSPVCQQICEKIIEMFKNNVPQRKIGRHLDISPSTVHNIIKRFKESGGISVHKGQGCKPKLNNRDLR SLRRHCIKNRHSSISDITTWAQDYFGKPLSSTTIHSYIHKCQLKLYCAKRKPYVNSVQKRCRLLWARRHL GWTITQWKCVLWSDESVFQVFFGRNGRRVLRTKEEKDHPDCYQQQVQKPGSVMVWGCVSALGKGNLHFCD GTINAEKYIEILEHNMLPSRRYIFQGRPCIFQQDNAKPHSAHITKSWLRRKRIQVLDWPVCSPNLSPIEK VWCILCGKMLQRRPCTVAHLKTCLQEEWDKITPETLHHLVSSVPKRLLSVVKRNGNITKW
|
|||
Derived: [3] (Consensus) |
|||
Download Sequence - Format: IG, EMBL, FASTA |
|||
References:
|