Repbase Reports |
|---|
| 2002, Volume 2, Issue 3 |
| March 31, 2002 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 6 |
LOOPER1_DM |
|||
|---|---|---|---|
LOOPER1_DM DNA transposon - a consensus sequence. |
|||
|
Submitted: 31-Mar-2002 |
Accepted: 31-Mar-2002 |
||
|
Key Words: DNA transposon; Looper/PiggyBac superfamily; transposase; TTAA; LOOPER1_Dm; LOOPER1_DM |
|||
|
Source: consensus |
Organism: Drosophila melanogaster |
Taxonomy: Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: Looper1_DM, a family of Looper/PiggyBac DNA transposons in D. melanogaster. |
|||
|
Journal: Repbase Reports 2:(3) p. 6 (2002) |
|||
Abstract: LOOPER1_DM belongs to the Looper/PiggyBac superfamily of "cut and paste" DNA transposons. This family was active in a recent past (several million years ago). It has 16-bp TIRs (one mismatch) and its copies are flanked by the 4-bp TTAA target site duplications. The consensus sequence was reconstructed based on alignment of 5 copies. LOOPER1_DM encodes the Looper1DMp transposase (positions 505-1542). Looper1DMp is closer to Looper/PiggyBac transposases identified in the human genome than to the PiggyBac transposase found in moth. Looper1DMp: MEDISTVLEKNLEGILERGESIEIDLLENTVIEGCEPDSCVVVDSCLEKIDPKTLKWRTRPFVAPESIWE DDKTFDVGEIKTPVEFFYTLFDTQLIHLMARQTDIYSLQEHGIELKCTDEEIKRYIGILLYFGVLKLPQF RMAWSKDLKITAITDSMPRGRFKKIKQCLHFNDNAKQLKKGDCNYDKLYKIRPLLRILKENFGKTNAGRA SKCRXANNCIQRYVFNFLLNLLYFYXLLLLQVDPRLYNPNLINGVLKLFTRAGISGLVYDFTLYVGEGTS PSYGLGISSYVVLYLAESLPKDKNFKLYFDNWFTSVILLISLKEIGIFATGTVRMIKLNIGXFLEKEDVA DCAKLQHR
|
|||
|
Derived: [1] (Consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||