Repbase Reports |
|---|
| 2002, Volume 2, Issue 10 |
| October 31, 2002 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 30 |
TC1-2_DM |
|||
|---|---|---|---|
TC1-2_DM is a DNA transposon, a consensus sequence. |
|||
|
Submitted: 31-Oct-2002 |
Accepted: 31-Oct-2002 |
||
|
Key Words: DNA transposon; Mariner/Tc1-superfamily; transposase; TC1-2_DM |
|||
|
Source: consensus |
Organism: Drosophila melanogaster |
Taxonomy: Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: TC1-2_DM, a family of Mariner/Tc1 DNA transposons from D. melanogaster. |
|||
|
Journal: Repbase Reports 2:(10) p. 30 (2002) |
|||
Abstract: TC1-2_DM belongs to the Mariner/Tc1 superfamily of DNA transposons. It has generated duplications of TA target sites upon its integration into the genome. TC1-2_DM has 26-bp imperfect terminal inverted repeats and it encodes a 340-aa transposase (TC1-2_DMp, positions 356-1375). The sequenced portion of the drosophila genome contains 15 copies of TC1-2_DM. they are ~95% identical to the consensus sequence. Presumably, TC1-2_DM lost its activity just a few million years ago. TC1-2_DMp: MGKTKELSEFIKNEIIIKYNSGISVQNIIDLYKIPRATVYYQINKYKKTHTTKNVARSGRPRKTTQKDDG YILRKFKQNVLQTPRSVAKELKEGAEIDISERTVRRRLKEADFGTYVSRVIPLITPRNKLKRLDFAKKYV GQPASFWNNVLWSDESSFEFHCSKKIFFVRLPKQYRKKVAPVCQRINHSGGSVMFWGCVAFTGLGDLVPV DGTMNQRKYLDVLNNHAFPSGDKLIGESFILQQDNAPCHKAKLITQFLKDVCVNTLDWPPQSPDLNIIEN LWSYLKRKRSANLSRSREETILEIQTLWKDISIDYIHSLVQSVPKRLQKVIDAKGGYIFY
|
|||
|
Derived: [1] (Consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||